Brand: | Abnova |
Reference: | H00001147-M03 |
Product name: | CHUK monoclonal antibody (M03), clone 4B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHUK. |
Clone: | 4B8 |
Isotype: | IgG1 Kappa |
Gene id: | 1147 |
Gene name: | CHUK |
Gene alias: | IKBKA|IKK-alpha|IKK1|IKKA|NFKBIKA|TCF16 |
Gene description: | conserved helix-loop-helix ubiquitous kinase |
Genbank accession: | NM_001278 |
Immunogen: | CHUK (NP_001269, 646 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE |
Protein accession: | NP_001269 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to CHUK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |