Login to display prices
Login to display prices
CHUK monoclonal antibody (M03), clone 4B8 View larger

CHUK monoclonal antibody (M03), clone 4B8

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHUK monoclonal antibody (M03), clone 4B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about CHUK monoclonal antibody (M03), clone 4B8

Reference: H00001147-M03
Product name: CHUK monoclonal antibody (M03), clone 4B8
Product description: Mouse monoclonal antibody raised against a partial recombinant CHUK.
Clone: 4B8
Isotype: IgG1 Kappa
Gene id: 1147
Gene name: CHUK
Gene alias: IKBKA|IKK-alpha|IKK1|IKKA|NFKBIKA|TCF16
Gene description: conserved helix-loop-helix ubiquitous kinase
Genbank accession: NM_001278
Immunogen: CHUK (NP_001269, 646 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE
Protein accession: NP_001269
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: