No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00027330-M04 |
| Product name: | RPS6KA6 monoclonal antibody (M04), clone 8E8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RPS6KA6. |
| Clone: | 8E8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 27330 |
| Gene name: | RPS6KA6 |
| Gene alias: | RSK4 |
| Gene description: | ribosomal protein S6 kinase, 90kDa, polypeptide 6 |
| Genbank accession: | NM_014496 |
| Immunogen: | RPS6KA6 (NP_055311.1, 636 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL |
| Protein accession: | NP_055311.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | Immunoperoxidase of monoclonal antibody to RPS6KA6 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,ELISA,WB-Re |
| Shipping condition: | Dry Ice |