Cart 75 Product Products 25 187,18 € (empty)
No products
To be determined Shipping
25 187,18 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 75 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 25 187,18 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 25 187,18 €
Data sheet of GST (Schistosoma japonicum) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Origin species | S. japonicum |
| Host species | Escherichia coli (E. coli) |
| Applications | Func,SDS-PAGE |
More info about GST (Schistosoma japonicum) Recombinant Protein
| Reference: | P4994 |
| Product name: | GST (Schistosoma japonicum) Recombinant Protein |
| Product description: | Schistosoma japonicum GST (P08515, 1 a.a. - 224 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli (E. coli). |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPR |
| Protein accession: | P08515 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli (E. coli) expression system |
| Storage buffer: | In PBS, pH 7.4 (10% glycerol) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Tag: | His |
| Shipping condition: | Dry Ice |