| Brand: | Abnova |
| Reference: | H00008320-M14 |
| Product name: | EOMES monoclonal antibody (M14), clone 2D3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant EOMES. |
| Clone: | 2D3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8320 |
| Gene name: | EOMES |
| Gene alias: | TBR2 |
| Gene description: | eomesodermin homolog (Xenopus laevis) |
| Genbank accession: | NM_005442 |
| Immunogen: | EOMES (NP_005433.2, 461 a.a. ~ 569 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTF |
| Protein accession: | NP_005433.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | EOMES monoclonal antibody (M14), clone 2D3 Western Blot analysis of EOMES expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |