NID1 monoclonal antibody (M01), clone 1G3 View larger

NID1 monoclonal antibody (M01), clone 1G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NID1 monoclonal antibody (M01), clone 1G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about NID1 monoclonal antibody (M01), clone 1G3

Brand: Abnova
Reference: H00004811-M01
Product name: NID1 monoclonal antibody (M01), clone 1G3
Product description: Mouse monoclonal antibody raised against a partial recombinant NID1.
Clone: 1G3
Isotype: IgG2a Kappa
Gene id: 4811
Gene name: NID1
Gene alias: NID
Gene description: nidogen 1
Genbank accession: NM_002508
Immunogen: NID1 (NP_002499.1, 1148 a.a. ~ 1247 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITTALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIERK
Protein accession: NP_002499.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004811-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004811-M01-13-15-1.jpg
Application image note: Western Blot analysis of NID1 expression in transfected 293T cell line by NID1 monoclonal antibody (M01), clone 1G3.

Lane 1: NID1 transfected lysate(122.1 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NID1 monoclonal antibody (M01), clone 1G3 now

Add to cart