No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA |
| Brand: | Abnova |
| Reference: | H00028862-M01 |
| Product name: | IGKV1OR2-108 monoclonal antibody (M01), clone 3A11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IGKV1OR2-108. |
| Clone: | 3A11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 28862 |
| Gene name: | IGKV1OR2-108 |
| Gene alias: | IGKV1OR2108|IGO1 |
| Gene description: | immunoglobulin kappa variable 1/OR2-108 (non-functional) |
| Genbank accession: | X51887.1 |
| Immunogen: | IGKV1OR2-108 (CAA36171.1, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DIQVTQSPSSLSASVGDRVTITCRASQGISNGLSWYQQKPGQAPTLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCLQDYTTP |
| Protein accession: | CAA36171.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged IGKV1OR2-108 is 0.3 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |