Cart 67 Product Products 27 010,06 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x CD15...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
27 010,06 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 67 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 27 010,06 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 27 010,06 €
Data sheet of HAND2 monoclonal antibody (M06), clone 3D5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about HAND2 monoclonal antibody (M06), clone 3D5
| Brand: | Abnova |
| Reference: | H00009464-M06 |
| Product name: | HAND2 monoclonal antibody (M06), clone 3D5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HAND2. |
| Clone: | 3D5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9464 |
| Gene name: | HAND2 |
| Gene alias: | DHAND2|FLJ16260|Hed|MGC125303|MGC125304|Thing2|bHLHa26|dHand |
| Gene description: | heart and neural crest derivatives expressed 2 |
| Genbank accession: | NM_021973 |
| Immunogen: | HAND2 (NP_068808.1, 135 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK |
| Protein accession: | NP_068808.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of HAND2 expression in transfected 293T cell line by HAND2 monoclonal antibody (M06), clone 3D5. Lane 1: HAND2 transfected lysate(21.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Progestin-induced heart and neural crest derivatives expressed transcript 2 is associated with fibulin-1 expression in human endometrial stromal cells.Cho H, Okada H, Tsuzuki T, Nishigaki A, Yasuda K, Kanzaki H. Fertil Steril. 2012 Oct 1. pii: S0015-0282(12)02175-9. doi: 10.1016/j.fertnstert.2012.08.056. |