Brand: | Abnova |
Reference: | H00009576-M01 |
Product name: | SPAG6 monoclonal antibody (M01), clone 3E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SPAG6. |
Clone: | 3E3 |
Isotype: | IgG3 Kappa |
Gene id: | 9576 |
Gene name: | SPAG6 |
Gene alias: | DKFZp434I153|MGC26276|Repro-SA-1|pf16 |
Gene description: | sperm associated antigen 6 |
Genbank accession: | NM_012443 |
Immunogen: | SPAG6 (NP_036575, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYK |
Protein accession: | NP_036575 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SPAG6 monoclonal antibody (M01), clone 3E3 Western Blot analysis of SPAG6 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |