| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
| Brand: | Abnova |
| Reference: | P4631 |
| Product name: | Il21 (Mouse) Recombinant Protein |
| Product description: | Mouse Il21 (Q9ES17) recombinant protein expressed in Escherichia coli. |
| Gene id: | 60505 |
| Gene name: | Il21 |
| Gene alias: | - |
| Gene description: | interleukin 21 |
| Immunogen sequence/protein sequence: | MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS |
| Protein accession: | Q9ES17 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | Lyophilized with 20 mM NaHCO3, pH 8.5. |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Serial dilutions of mouse Il21 (starting at 100 ng/mL) or ConA (+ control) were added to primary mouse thymocytes cultured on an anti-cD3e coated plate. After 72 hours, total live thymoctyes were measured and the linear portion of the curve was us used to calculate the ED50. |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |