No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00002214-M03A |
| Product name: | FCGR3A monoclonal antibody (M03A), clone 2B11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant FCGR3A. |
| Clone: | 2B11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2214 |
| Gene name: | FCGR3A |
| Gene alias: | CD16|CD16A|FCG3|FCGR3|FCGRIII|FCR-10|FCRIII|FCRIIIA|IGFR3 |
| Gene description: | Fc fragment of IgG, low affinity IIIa, receptor (CD16a) |
| Genbank accession: | BC017865 |
| Immunogen: | FCGR3A (AAH17865.1, 17 a.a. ~ 254 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK |
| Protein accession: | AAH17865.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (51.92 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | FCGR3A monoclonal antibody (M03A), clone 2B11. Western Blot analysis of FCGR3A expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |