Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HIST2H2BE monoclonal antibody (M06), clone 4G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA |
More info about HIST2H2BE monoclonal antibody (M06), clone 4G6
| Brand: | Abnova |
| Reference: | H00008349-M06 |
| Product name: | HIST2H2BE monoclonal antibody (M06), clone 4G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HIST2H2BE. |
| Clone: | 4G6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8349 |
| Gene name: | HIST2H2BE |
| Gene alias: | GL105|H2B|H2B.1|H2B/q|H2BFQ|MGC119802|MGC119804|MGC129733|MGC129734 |
| Gene description: | histone cluster 2, H2be |
| Genbank accession: | NM_003528 |
| Immunogen: | HIST2H2BE (NP_003519.1, 36 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK |
| Protein accession: | NP_003519.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged HIST2H2BE is approximately 3ng/ml as a capture antibody. |
| Applications: | IHC-P,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |