Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATP6AP1 monoclonal antibody (M01), clone 3A2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about ATP6AP1 monoclonal antibody (M01), clone 3A2
| Brand: | Abnova |
| Reference: | H00000537-M01 |
| Product name: | ATP6AP1 monoclonal antibody (M01), clone 3A2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP6AP1. |
| Clone: | 3A2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 537 |
| Gene name: | ATP6AP1 |
| Gene alias: | 16A|ATP6IP1|ATP6S1|Ac45|CF2|MGC129781|VATPS1|XAP-3|XAP3 |
| Gene description: | ATPase, H+ transporting, lysosomal accessory protein 1 |
| Genbank accession: | NM_001183 |
| Immunogen: | ATP6AP1 (NP_001174, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE |
| Protein accession: | NP_001174 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | ATP6AP1 monoclonal antibody (M01), clone 3A2 Western Blot analysis of ATP6AP1 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Vacuolar H+-ATPase subunit Voa1 and Voa2 cooperatively regulate secretory vesicle acidification, transmitter uptake and storage.Saw NM, Kang SY, Parsaud L, Han GA, Jiang T, Grzegorczyk K, Surkont M, Sun-Wada GH, Wada Y, Li L, Sugita S. Mol Biol Cell. 2011 Jul 27. [Epub ahead of print] |