No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00389874-M02 |
Product name: | ZCCHC13 monoclonal antibody (M02), clone 4G11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant ZCCHC13. |
Clone: | 4G11 |
Isotype: | IgG2a Kappa |
Gene id: | 389874 |
Gene name: | ZCCHC13 |
Gene alias: | Cnbp2|ZNF9L |
Gene description: | zinc finger, CCHC domain containing 13 |
Genbank accession: | NM_203303.1 |
Immunogen: | ZCCHC13 (NP_976048.1, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNCGRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMSQ |
Protein accession: | NP_976048.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (44.4 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ZCCHC13 expression in transfected 293T cell line by ZCCHC13 monoclonal antibody (M02), clone 4G11. Lane 1: ZCCHC13 transfected lysate (Predicted MW: 18 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |