PCDHB12 monoclonal antibody (M05), clone 1D11 View larger

PCDHB12 monoclonal antibody (M05), clone 1D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDHB12 monoclonal antibody (M05), clone 1D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PCDHB12 monoclonal antibody (M05), clone 1D11

Brand: Abnova
Reference: H00056124-M05
Product name: PCDHB12 monoclonal antibody (M05), clone 1D11
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDHB12.
Clone: 1D11
Isotype: IgG2a Kappa
Gene id: 56124
Gene name: PCDHB12
Gene alias: PCDH-BETA12
Gene description: protocadherin beta 12
Genbank accession: NM_018932
Immunogen: PCDHB12 (NP_061755, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ITLTAPLDFEAIESYSIIIQATDGGGLFGKSTVRIQVMDVNDNAPEITVSSITSPIPENTPETVVMVFRIRDRDSGDNGKMVCSIPEDIPFVLKSSVNNY
Protein accession: NP_061755
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00056124-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00056124-M05-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged PCDHB12 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCDHB12 monoclonal antibody (M05), clone 1D11 now

Add to cart