GNG7 monoclonal antibody (M01), clone 1C11-1B3 View larger

GNG7 monoclonal antibody (M01), clone 1C11-1B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GNG7 monoclonal antibody (M01), clone 1C11-1B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GNG7 monoclonal antibody (M01), clone 1C11-1B3

Brand: Abnova
Reference: H00002788-M01
Product name: GNG7 monoclonal antibody (M01), clone 1C11-1B3
Product description: Mouse monoclonal antibody raised against a full length recombinant GNG7.
Clone: 1C11-1B3
Isotype: IgG1 kappa
Gene id: 2788
Gene name: GNG7
Gene alias: FLJ00058
Gene description: guanine nucleotide binding protein (G protein), gamma 7
Genbank accession: BC014466
Immunogen: GNG7 (AAH14466, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
Protein accession: AAH14466
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002788-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.22 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00002788-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged GNG7 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GNG7 monoclonal antibody (M01), clone 1C11-1B3 now

Add to cart