| Brand: | Abnova |
| Reference: | H00002788-M01 |
| Product name: | GNG7 monoclonal antibody (M01), clone 1C11-1B3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant GNG7. |
| Clone: | 1C11-1B3 |
| Isotype: | IgG1 kappa |
| Gene id: | 2788 |
| Gene name: | GNG7 |
| Gene alias: | FLJ00058 |
| Gene description: | guanine nucleotide binding protein (G protein), gamma 7 |
| Genbank accession: | BC014466 |
| Immunogen: | GNG7 (AAH14466, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL |
| Protein accession: | AAH14466 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.22 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged GNG7 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |