| Brand: | Abnova |
| Reference: | H00030849-M01A |
| Product name: | PIK3R4 monoclonal antibody (M01A), clone 1D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PIK3R4. |
| Clone: | 1D4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 30849 |
| Gene name: | PIK3R4 |
| Gene alias: | MGC102700|VPS15|p150 |
| Gene description: | phosphoinositide-3-kinase, regulatory subunit 4 |
| Genbank accession: | NM_014602 |
| Immunogen: | PIK3R4 (NP_055417, 1259 a.a. ~ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK |
| Protein accession: | NP_055417 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PIK3R4 monoclonal antibody (M01A), clone 1D4 Western Blot analysis of PIK3R4 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |