| Brand: | Abnova |
| Reference: | H00092283-M01 |
| Product name: | GIOT-1 monoclonal antibody (M01), clone 4G11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GIOT-1. |
| Clone: | 4G11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 92283 |
| Gene name: | ZNF461 |
| Gene alias: | GIOT-1|GIOT1|MGC33911 |
| Gene description: | zinc finger protein 461 |
| Genbank accession: | NM_153257 |
| Immunogen: | GIOT-1 (NP_694989.2, 121 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKEL |
| Protein accession: | NP_694989.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ZNF461 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |