No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00092283-M01 |
Product name: | GIOT-1 monoclonal antibody (M01), clone 4G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GIOT-1. |
Clone: | 4G11 |
Isotype: | IgG2a Kappa |
Gene id: | 92283 |
Gene name: | ZNF461 |
Gene alias: | GIOT-1|GIOT1|MGC33911 |
Gene description: | zinc finger protein 461 |
Genbank accession: | NM_153257 |
Immunogen: | GIOT-1 (NP_694989.2, 121 a.a. ~ 218 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKEL |
Protein accession: | NP_694989.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged ZNF461 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |