Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DYRK1A monoclonal antibody (M01), clone 7D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about DYRK1A monoclonal antibody (M01), clone 7D10
| Brand: | Abnova |
| Reference: | H00001859-M01 |
| Product name: | DYRK1A monoclonal antibody (M01), clone 7D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DYRK1A. |
| Clone: | 7D10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 1859 |
| Gene name: | DYRK1A |
| Gene alias: | DYRK|DYRK1|HP86|MNB|MNBH |
| Gene description: | dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A |
| Genbank accession: | NM_001396 |
| Immunogen: | DYRK1A (NP_001387, 674 a.a. ~ 763 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS |
| Protein accession: | NP_001387 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DYRK1A is approximately 0.03ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Hyperhomocysteinemia-induced Dyrk1a downregulation results in cardiomyocyte hypertrophy in rats.Raaf L, Noll C, Cherifi M, Benazzoug Y, Delabar JM, Janel N. Int J Cardiol. 2009 Nov 9. [Epub ahead of print] |