Login to display prices
Login to display prices
ATP11B monoclonal antibody (M01), clone 4H8 View larger

ATP11B monoclonal antibody (M01), clone 4H8

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP11B monoclonal antibody (M01), clone 4H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ATP11B monoclonal antibody (M01), clone 4H8

Reference: H00023200-M01
Product name: ATP11B monoclonal antibody (M01), clone 4H8
Product description: Mouse monoclonal antibody raised against a partial recombinant ATP11B.
Clone: 4H8
Isotype: IgG1 Kappa
Gene id: 23200
Gene name: ATP11B
Gene alias: ATPIF|ATPIR|DKFZp434J238|DKFZp434N1615|KIAA0956|MGC46576
Gene description: ATPase, class VI, type 11B
Genbank accession: NM_014616
Immunogen: ATP11B (NP_055431, 1087 a.a. ~ 1177 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC
Protein accession: NP_055431
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: