ATP11B monoclonal antibody (M01), clone 4H8 View larger

ATP11B monoclonal antibody (M01), clone 4H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP11B monoclonal antibody (M01), clone 4H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ATP11B monoclonal antibody (M01), clone 4H8

Brand: Abnova
Reference: H00023200-M01
Product name: ATP11B monoclonal antibody (M01), clone 4H8
Product description: Mouse monoclonal antibody raised against a partial recombinant ATP11B.
Clone: 4H8
Isotype: IgG1 Kappa
Gene id: 23200
Gene name: ATP11B
Gene alias: ATPIF|ATPIR|DKFZp434J238|DKFZp434N1615|KIAA0956|MGC46576
Gene description: ATPase, class VI, type 11B
Genbank accession: NM_014616
Immunogen: ATP11B (NP_055431, 1087 a.a. ~ 1177 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC
Protein accession: NP_055431
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023200-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.75 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - ARL6IP monoclonal antibody (M09), clone 4F9
- SYT11 monoclonal antibody (M03), clone 4E1
- SULF1 monoclonal antibody (M01A), clone 1A4
- FBXO28 monoclonal antibody (M01), clone 3E5
- RHOBTB2 monoclonal antibody (M02), clone 2G6
Shipping condition: Dry Ice

Buy ATP11B monoclonal antibody (M01), clone 4H8 now

Add to cart