FGR monoclonal antibody (M01), clone 3G10 View larger

FGR monoclonal antibody (M01), clone 3G10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FGR monoclonal antibody (M01), clone 3G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about FGR monoclonal antibody (M01), clone 3G10

Brand: Abnova
Reference: H00002268-M01
Product name: FGR monoclonal antibody (M01), clone 3G10
Product description: Mouse monoclonal antibody raised against a partial recombinant FGR.
Clone: 3G10
Isotype: IgG2a Kappa
Gene id: 2268
Gene name: FGR
Gene alias: FLJ43153|MGC75096|SRC2|c-fgr|c-src2|p55c-fgr|p58c-fgr
Gene description: Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
Genbank accession: BC064382
Immunogen: FGR (AAH64382, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA
Protein accession: AAH64382
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00002268-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00002268-M01-3-10-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FGR monoclonal antibody (M01), clone 3G10 now

Add to cart