| Brand: | Abnova |
| Reference: | H00064710-M02 |
| Product name: | NUCKS1 monoclonal antibody (M02), clone 3G10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant NUCKS1. |
| Clone: | 3G10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 64710 |
| Gene name: | NUCKS1 |
| Gene alias: | FLJ21480|FLJ32016|FLJ38536|JC7|NUCKS |
| Gene description: | nuclear casein kinase and cyclin-dependent kinase substrate 1 |
| Genbank accession: | NM_022731.2 |
| Immunogen: | NUCKS1 (NP_073568.2, 1 a.a. ~ 243 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED |
| Protein accession: | NP_073568.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (53.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged NUCKS1 is 0.3 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |