Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MYL2 monoclonal antibody (M01), clone 3B9-B4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,IP |
More info about MYL2 monoclonal antibody (M01), clone 3B9-B4
| Brand: | Abnova |
| Reference: | H00004633-M01 |
| Product name: | MYL2 monoclonal antibody (M01), clone 3B9-B4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant MYL2. |
| Clone: | 3B9-B4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4633 |
| Gene name: | MYL2 |
| Gene alias: | CMH10|DKFZp779C0562|MLC2 |
| Gene description: | myosin, light chain 2, regulatory, cardiac, slow |
| Genbank accession: | BC015821 |
| Immunogen: | MYL2 (AAH15821.1, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD |
| Protein accession: | AAH15821.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (44 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MYL2 is 0.03 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |
| Publications: | Drastic increase of myosin light chain MLC-2 in senescent skeletal muscle indicates fast-to-slow fibre transition in sarcopenia of old age.Gannon J, Doran P, Kirwan A, Ohlendieck K. Eur J Cell Biol. 2009 Nov;88(11):685-700. Epub 2009 Jul 19. |