Brand: | Abnova |
Reference: | H00004633-M01 |
Product name: | MYL2 monoclonal antibody (M01), clone 3B9-B4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MYL2. |
Clone: | 3B9-B4 |
Isotype: | IgG1 Kappa |
Gene id: | 4633 |
Gene name: | MYL2 |
Gene alias: | CMH10|DKFZp779C0562|MLC2 |
Gene description: | myosin, light chain 2, regulatory, cardiac, slow |
Genbank accession: | BC015821 |
Immunogen: | MYL2 (AAH15821.1, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD |
Protein accession: | AAH15821.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MYL2 is 0.03 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |
Publications: | Drastic increase of myosin light chain MLC-2 in senescent skeletal muscle indicates fast-to-slow fibre transition in sarcopenia of old age.Gannon J, Doran P, Kirwan A, Ohlendieck K. Eur J Cell Biol. 2009 Nov;88(11):685-700. Epub 2009 Jul 19. |