RDH11 monoclonal antibody (M01), clone 1H6 View larger

RDH11 monoclonal antibody (M01), clone 1H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RDH11 monoclonal antibody (M01), clone 1H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about RDH11 monoclonal antibody (M01), clone 1H6

Brand: Abnova
Reference: H00051109-M01
Product name: RDH11 monoclonal antibody (M01), clone 1H6
Product description: Mouse monoclonal antibody raised against a full length recombinant RDH11.
Clone: 1H6
Isotype: IgG1 lambda
Gene id: 51109
Gene name: RDH11
Gene alias: ARSDR1|CGI-82|FLJ32633|HCBP12|MDT1|PSDR1|RALR1|SCALD|SDR7C1
Gene description: retinol dehydrogenase 11 (all-trans/9-cis/11-cis)
Genbank accession: BC000112
Immunogen: RDH11 (AAH00112, 24 a.a. ~ 318 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID
Protein accession: AAH00112
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051109-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (58.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051109-M01-1-1-1.jpg
Application image note: RDH11 monoclonal antibody (M01), clone 1H6 Western Blot analysis of RDH11 expression in Hela ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RDH11 monoclonal antibody (M01), clone 1H6 now

Add to cart