| Brand: | Abnova |
| Reference: | H00342184-M07 |
| Product name: | FMN1 monoclonal antibody (M07), clone 4F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FMN1. |
| Clone: | 4F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 342184 |
| Gene name: | FMN1 |
| Gene alias: | DKFZp686C2281|DKFZp686G2387|FLJ45135|FMN|LD|MGC125288|MGC125289 |
| Gene description: | formin 1 |
| Genbank accession: | XM_375185 |
| Immunogen: | FMN1 (XP_375185.1, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MENVDNSLDGSDVSEPAKPEAGLEVAQSILSKFSMKSLFGFTSKLESVNPEEEDAVLKAFHSLDVNPTSQQDDSSNGLDPQEAGSRVSPDLGNDEKIASVETESEGSQR |
| Protein accession: | XP_375185.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FMN1 monoclonal antibody (M07), clone 4F4. Western Blot analysis of FMN1 expression in Jurkat. |
| Applications: | WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |