Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 422,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 422,00 €
Data sheet of C21orf59 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Tr |
More info about C21orf59 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00056683-B01P |
| Product name: | C21orf59 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human C21orf59 protein. |
| Gene id: | 56683 |
| Gene name: | C21orf59 |
| Gene alias: | C21orf48|FLJ20467|FLJ37137|FLJ40247 |
| Gene description: | chromosome 21 open reading frame 59 |
| Genbank accession: | NM_021254.1 |
| Immunogen: | C21orf59 (NP_067077.1, 1 a.a. ~ 290 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFHGVKDIKWRPR |
| Protein accession: | NP_067077.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of C21orf59 expression in transfected 293T cell line (H00056683-T01) by C21orf59 MaxPab polyclonal antibody. Lane 1: C21orf59 transfected lysate(31.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |