No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
| Brand: | Abnova |
| Reference: | H00051548-M01 |
| Product name: | SIRT6 monoclonal antibody (M01), clone 1D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SIRT6. |
| Clone: | 1D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51548 |
| Gene name: | SIRT6 |
| Gene alias: | SIR2L6 |
| Gene description: | sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae) |
| Genbank accession: | NM_016539 |
| Immunogen: | SIRT6 (NP_057623.1, 141 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHA |
| Protein accession: | NP_057623.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged SIRT6 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | SIRT6 expression is associated with poor prognosis and chemosensitivity in patients with non-small cell lung cancer.Azuma Y, Yokobori T, Mogi A, Altan B, Yajima T, Kosaka T, Onozato R, Yamaki E, Asao T, Nishiyama M, Kuwano H. J Surg Oncol. 2015 Jul 15. [Epub ahead of print] |