Product successfully added to your shopping cart
Quantity
Total
There are 7 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 536,38 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 536,38 €
Data sheet of RFXANK monoclonal antibody (M01), clone 4G10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about RFXANK monoclonal antibody (M01), clone 4G10
| Brand: | Abnova |
| Reference: | H00008625-M01 |
| Product name: | RFXANK monoclonal antibody (M01), clone 4G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RFXANK. |
| Clone: | 4G10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8625 |
| Gene name: | RFXANK |
| Gene alias: | ANKRA1|BLS|F14150_1|MGC138628|RFX-B |
| Gene description: | regulatory factor X-associated ankyrin-containing protein |
| Genbank accession: | NM_003721 |
| Immunogen: | RFXANK (NP_003712.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MELTQPAEDLIQTQQTPASELGDPEDPGEEAADGSDTVVLSLFPCTPEPVNPEPDASVSSPQAGSSLKHSTTLTNRQRGNEVSALPATLD |
| Protein accession: | NP_003712.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged RFXANK is approximately 3ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |