Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 185,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 185,00 €
Data sheet of CCRK monoclonal antibody (M13), clone 3E11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about CCRK monoclonal antibody (M13), clone 3E11
| Brand: | Abnova |
| Reference: | H00023552-M13 |
| Product name: | CCRK monoclonal antibody (M13), clone 3E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CCRK. |
| Clone: | 3E11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23552 |
| Gene name: | CCRK |
| Gene alias: | CDCH|p42 |
| Gene description: | cell cycle related kinase |
| Genbank accession: | BC002655 |
| Immunogen: | CCRK (AAH02655.1, 183 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIA |
| Protein accession: | AAH02655.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.88 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CCRK expression in transfected 293T cell line by CCRK monoclonal antibody (M13), clone 3E11. Lane 1: CCRK transfected lysate(30.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |