CXX1 purified MaxPab mouse polyclonal antibody (B01P) View larger

CXX1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CXX1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CXX1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00008933-B01P
Product name: CXX1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CXX1 protein.
Gene id: 8933
Gene name: FAM127A
Gene alias: CXX1|MAR8C|MART8C|MGC117411|Mar8|Mart8
Gene description: family with sequence similarity 127, member A
Genbank accession: BC002410
Immunogen: CXX1 (AAH02410, 1 a.a. ~ 209 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGGGRGLLGRETLGPGGGCSGEGPLCYWPPPGSPPAPSLRASLPLEPPRCPLRSCSLPRSACLCSRNSAPGSCCRPWASLWSEPPPSPSSQPAPPMYIWTLSCAPAASWAPVTHWTDHPLPPLPSPLLPTRLPDDYIILPTDLRCHSHRHPSHPTDRLLLLVIWTHLGGIWAGHSPWTVIQTAGRPPRDLSPSARPISSPPPETSCVLA
Protein accession: AAH02410
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008933-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CXX1 expression in transfected 293T cell line by CXX1 MaxPab polyclonal antibody.

Lane 1: CXX1 transfected lysate(22.99 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Buy CXX1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart