Cart 127 Product Products 45 742,85 € (empty)
Product successfully added to your shopping cart
Quantity
Total
There are 127 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 45 742,85 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 45 742,85 €
Data sheet of GSC monoclonal antibody (M14), clone 3G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,ELISA |
More info about GSC monoclonal antibody (M14), clone 3G6
| Brand: | Abnova |
| Reference: | H00145258-M14 |
| Product name: | GSC monoclonal antibody (M14), clone 3G6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant GSC. |
| Clone: | 3G6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 145258 |
| Gene name: | GSC |
| Gene alias: | - |
| Gene description: | goosecoid homeobox |
| Genbank accession: | NM_173849 |
| Immunogen: | GSC (NP_776248, 78 a.a. ~ 186 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LGYNNYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPD |
| Protein accession: | NP_776248 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to GSC on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,ELISA |
| Shipping condition: | Dry Ice |