No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00084447-M01 |
Product name: | SYVN1 monoclonal antibody (M01), clone 4H4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SYVN1. |
Clone: | 4H4 |
Isotype: | IgG2b Kappa |
Gene id: | 84447 |
Gene name: | SYVN1 |
Gene alias: | HRD1|KIAA1810|MGC40372 |
Gene description: | synovial apoptosis inhibitor 1, synoviolin |
Genbank accession: | NM_032431 |
Immunogen: | SYVN1 (NP_079434, 238 a.a. ~ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRS |
Protein accession: | NP_079434 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (34.65 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SYVN1 expression in transfected 293T cell line by SYVN1 monoclonal antibody (M01), clone 4H4. Lane 1: SYVN1 transfected lysate(67.685 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |