LAMP5 polyclonal antibody View larger

LAMP5 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LAMP5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about LAMP5 polyclonal antibody

Brand: Abnova
Reference: PAB21915
Product name: LAMP5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LAMP5.
Isotype: IgG
Gene id: 24141
Gene name: LAMP5
Gene alias: BAD-LAMP|BADLAMP|C20orf103|LAMP-5|UNC-43
Gene description: lysosomal-associated membrane protein family, member 5
Immunogen: Recombinant protein corresponding to amino acids of human LAMP5.
Immunogen sequence/protein sequence: FIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLA
Protein accession: Q9UJQ1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21915-48-A2-1.jpg
Application image note: Immunohistochemical staining of human colon with LAMP5 polyclonal antibody (Cat # PAB21915) shows distinct nuclear positivity in the basal portion of glandular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LAMP5 polyclonal antibody now

Add to cart