Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of C17orf37 MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about C17orf37 MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00084299-B01 |
| Product name: | C17orf37 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human C17orf37 protein. |
| Gene id: | 84299 |
| Gene name: | C17orf37 |
| Gene alias: | C35|MGC14832|ORB3|RDX12|XTP4 |
| Gene description: | chromosome 17 open reading frame 37 |
| Genbank accession: | NM_032339.3 |
| Immunogen: | C17orf37 (NP_115715.3, 1 a.a. ~ 115 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL |
| Protein accession: | NP_115715.3 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of C17orf37 expression in transfected 293T cell line (H00084299-T01) by C17orf37 MaxPab polyclonal antibody. Lane 1: C17orf37 transfected lysate(12.65 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Novel gene C17orf37 in 17q12 amplicon promotes migration and invasion of prostate cancer cells.Dasgupta S, Wasson LM, Rauniyar N, Prokai L, Borejdo J, Vishwanatha JK. Oncogene. 2009 Aug 13;28(32):2860-72. Epub 2009 Jun 8. |