| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | IHC,WB-Ce |
| Brand: | Abnova |
| Reference: | PAB28689 |
| Product name: | NDUFB7 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant NDUFB7, beta subcomplex 1. |
| Isotype: | IgG |
| Gene id: | 4713 |
| Gene name: | NDUFB7 |
| Gene alias: | B18|CI-B18|MGC2480 |
| Gene description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa |
| Immunogen: | Recombinant protein corresponding to amino acids of human NDUFB7. |
| Immunogen sequence/protein sequence: | FPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKV |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:20-1:50) Western Blot (1:100-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: | ![]() |
| Application image note: | Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells), Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla) with NDUFB7 polyclonal antibody (Cat # PAB28689). |
| Applications: | IHC,WB-Ce |
| Shipping condition: | Dry Ice |