Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DERL1 monoclonal antibody (M01), clone 1B9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA |
More info about DERL1 monoclonal antibody (M01), clone 1B9
| Brand: | Abnova |
| Reference: | H00079139-M01 |
| Product name: | DERL1 monoclonal antibody (M01), clone 1B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DERL1. |
| Clone: | 1B9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 79139 |
| Gene name: | DERL1 |
| Gene alias: | DER-1|DER1|FLJ13784|FLJ42092|MGC3067|PRO2577 |
| Gene description: | Der1-like domain family, member 1 |
| Genbank accession: | BC002457 |
| Immunogen: | DERL1 (AAH02457, 134 a.a. ~ 233 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQ |
| Protein accession: | AAH02457 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DERL1 monoclonal antibody (M01), clone 1B9. Western Blot analysis of DERL1 expression in HeLa. |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |