No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00007534-M04 |
Product name: | YWHAZ monoclonal antibody (M04), clone 1B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant YWHAZ. |
Clone: | 1B3 |
Isotype: | IgG1 Kappa |
Gene id: | 7534 |
Gene name: | YWHAZ |
Gene alias: | KCIP-1|MGC111427|MGC126532|MGC138156 |
Gene description: | tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide |
Genbank accession: | NM_003406.2 |
Immunogen: | YWHAZ (NP_003397.1, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQ |
Protein accession: | NP_003397.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of YWHAZ expression in transfected 293T cell line by YWHAZ monoclonal antibody (M04), clone 1B3. Lane 1: YWHAZ transfected lysate(27.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |