Login to display prices
Login to display prices
SNAI2 monoclonal antibody (M21), clone 3G9 View larger

SNAI2 monoclonal antibody (M21), clone 3G9

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNAI2 monoclonal antibody (M21), clone 3G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SNAI2 monoclonal antibody (M21), clone 3G9

Brand: Abnova
Reference: H00006591-M21
Product name: SNAI2 monoclonal antibody (M21), clone 3G9
Product description: Mouse monoclonal antibody raised against a partial recombinant SNAI2.
Clone: 3G9
Isotype: IgG2a Kappa
Gene id: 6591
Gene name: SNAI2
Gene alias: MGC10182|SLUG|SLUGH1|WS2D
Gene description: snail homolog 2 (Drosophila)
Genbank accession: BC014890
Immunogen: SNAI2 (AAH14890, 69 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCN
Protein accession: AAH14890
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00006591-M21-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - SMARCA2 monoclonal antibody (M06), clone 2D12
- SMARCB1 monoclonal antibody (M01), clone 3E10
- SMARCB1 monoclonal antibody (M02), clone 3E3
- SMARCB1 monoclonal antibody (M03), clone 3C4
- SMARCB1 monoclonal antibody (M04), clone 3H3
Shipping condition: Dry Ice