No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00006591-M21 |
Product name: | SNAI2 monoclonal antibody (M21), clone 3G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SNAI2. |
Clone: | 3G9 |
Isotype: | IgG2a Kappa |
Gene id: | 6591 |
Gene name: | SNAI2 |
Gene alias: | MGC10182|SLUG|SLUGH1|WS2D |
Gene description: | snail homolog 2 (Drosophila) |
Genbank accession: | BC014890 |
Immunogen: | SNAI2 (AAH14890, 69 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCN |
Protein accession: | AAH14890 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (32.78 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |