Cart 89 Product Products 34 673,14 € (empty)
Product successfully added to your shopping cart
Quantity
Total
There are 89 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 34 673,14 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 34 938,14 €
Data sheet of SNAI2 monoclonal antibody (M21), clone 3G9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SNAI2 monoclonal antibody (M21), clone 3G9
| Brand: | Abnova |
| Reference: | H00006591-M21 |
| Product name: | SNAI2 monoclonal antibody (M21), clone 3G9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SNAI2. |
| Clone: | 3G9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6591 |
| Gene name: | SNAI2 |
| Gene alias: | MGC10182|SLUG|SLUGH1|WS2D |
| Gene description: | snail homolog 2 (Drosophila) |
| Genbank accession: | BC014890 |
| Immunogen: | SNAI2 (AAH14890, 69 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCN |
| Protein accession: | AAH14890 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.78 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |