S100A4 MaxPab mouse polyclonal antibody (B01) View larger

S100A4 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of S100A4 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about S100A4 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00006275-B01
Product name: S100A4 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human S100A4 protein.
Gene id: 6275
Gene name: S100A4
Gene alias: 18A2|42A|CAPL|FSP1|MTS1|P9KA|PEL98
Gene description: S100 calcium binding protein A4
Genbank accession: BC016300
Immunogen: S100A4 (AAH16300, 1 a.a. ~ 101 a.a) full-length human protein.
Immunogen sequence/protein sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK
Protein accession: AAH16300
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006275-B01-13-15-1.jpg
Application image note: Western Blot analysis of S100A4 expression in transfected 293T cell line (H00006275-T01) by S100A4 MaxPab polyclonal antibody.

Lane1:S100A4 transfected lysate(11.22 KDa).
Lane 2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy S100A4 MaxPab mouse polyclonal antibody (B01) now

Add to cart