| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00010262-M03 |
| Product name: | SF3B4 monoclonal antibody (M03), clone 1B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SF3B4. |
| Clone: | 1B8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10262 |
| Gene name: | SF3B4 |
| Gene alias: | MGC10828|SAP49|SF3b49 |
| Gene description: | splicing factor 3b, subunit 4, 49kDa |
| Genbank accession: | NM_005850 |
| Immunogen: | SF3B4 (NP_005841.1, 13 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSA |
| Protein accession: | NP_005841.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SF3B4 expression in transfected 293T cell line by SF3B4 monoclonal antibody (M03), clone 1B8. Lane 1: SF3B4 transfected lysate(44.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |