No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00002934-M01 |
Product name: | GSN monoclonal antibody (M01), clone 3G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GSN. |
Clone: | 3G5 |
Isotype: | IgG1 Kappa |
Gene id: | 2934 |
Gene name: | GSN |
Gene alias: | DKFZp313L0718 |
Gene description: | gelsolin (amyloidosis, Finnish type) |
Genbank accession: | BC026033 |
Immunogen: | GSN (AAH26033, 673 a.a. ~ 782 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA |
Protein accession: | AAH26033 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to GSN on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |
Publications: | The effects of plasma gelsolin on human erythroblast maturation for erythrocyte production.Han SY, Lee EM, Choi HS, Chun BH, Baek EJ. Stem Cell Res. 2018 Mar 5;29:64-75. |