| Brand: | Abnova |
| Reference: | H00002934-M01 |
| Product name: | GSN monoclonal antibody (M01), clone 3G5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GSN. |
| Clone: | 3G5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2934 |
| Gene name: | GSN |
| Gene alias: | DKFZp313L0718 |
| Gene description: | gelsolin (amyloidosis, Finnish type) |
| Genbank accession: | BC026033 |
| Immunogen: | GSN (AAH26033, 673 a.a. ~ 782 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA |
| Protein accession: | AAH26033 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to GSN on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | The effects of plasma gelsolin on human erythroblast maturation for erythrocyte production.Han SY, Lee EM, Choi HS, Chun BH, Baek EJ. Stem Cell Res. 2018 Mar 5;29:64-75. |