| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00023235-M03 |
| Product name: | SIK2 monoclonal antibody (M03), clone 4C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SIK2. |
| Clone: | 4C6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 23235 |
| Gene name: | SIK2 |
| Gene alias: | DKFZp434K1115|KIAA0781|LOH11CR1I|QIK|SNF1LK2 |
| Gene description: | salt-inducible kinase 2 |
| Genbank accession: | NM_015191 |
| Immunogen: | SIK2 (NP_056006, 467 a.a. ~ 576 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AHAFEAFQSTRSGQRRHTLSEVTNQLVVMPGAGKIFSMNDSPSLDSVDSEYDMGSVQRDLNFLEDNPSLKDIMLANQPSPRMTSPFISLRPTNPAMQALSSQKREVHNRS |
| Protein accession: | NP_056006 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SIK2 expression in transfected 293T cell line by SIK2 monoclonal antibody (M03), clone 4C6. Lane 1: SIK2 transfected lysate (Predicted MW: 103.9 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |