NTE monoclonal antibody (M08), clone 3D10 View larger

NTE monoclonal antibody (M08), clone 3D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NTE monoclonal antibody (M08), clone 3D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about NTE monoclonal antibody (M08), clone 3D10

Brand: Abnova
Reference: H00010908-M08
Product name: NTE monoclonal antibody (M08), clone 3D10
Product description: Mouse monoclonal antibody raised against a partial recombinant NTE.
Clone: 3D10
Isotype: IgG2a Kappa
Gene id: 10908
Gene name: PNPLA6
Gene alias: NTE|NTEMND|SPG39|sws
Gene description: patatin-like phospholipase domain containing 6
Genbank accession: NM_006702
Immunogen: NTE (NP_006693.2, 1229 a.a. ~ 1327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ESRRADVLAFPSSGFTDLAEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGPDCSRDEGGSPEGASPSTASEMEEEKSILRQRRCLPQEPPGSATDA
Protein accession: NP_006693.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010908-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010908-M08-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PNPLA6 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NTE monoclonal antibody (M08), clone 3D10 now

Add to cart