No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00002916-M01 |
| Product name: | GRM6 monoclonal antibody (M01), clone 1A11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GRM6. |
| Clone: | 1A11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 2916 |
| Gene name: | GRM6 |
| Gene alias: | CSNB1B|DKFZp686H1993|GPRC1F|MGLUR6|mGlu6 |
| Gene description: | glutamate receptor, metabotropic 6 |
| Genbank accession: | NM_000843 |
| Immunogen: | GRM6 (NP_000834, 477 a.a. ~ 566 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ATNGSASSGGYQAVGQWAETLRLDVEALQWSGDPHEVPSSLCSLPCGPGERKKMVKGVPCCWHCEACDGYRFQVDEFTCEACPGDMRPTP |
| Protein accession: | NP_000834 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | GRM6 monoclonal antibody (M01), clone 1A11. Western Blot analysis of GRM6 expression in human spleen. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |