| Brand: | Abnova |
| Reference: | H00084941-M01 |
| Product name: | HSH2D monoclonal antibody (M01), clone 1D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HSH2D. |
| Clone: | 1D6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 84941 |
| Gene name: | HSH2D |
| Gene alias: | ALX|FLJ14886|HSH2 |
| Gene description: | hematopoietic SH2 domain containing |
| Genbank accession: | NM_032855 |
| Immunogen: | HSH2D (NP_116244.1, 251 a.a. ~ 352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SQDHSGDPTSGDRGYTDPCVATSLKSPSQPQAPKDRKVPTRKAERSVSCIEVTPGDRSWHQMVVRALSSQESKPEHQGLAEPENDQLPEEYQQPPPFAPGYC |
| Protein accession: | NP_116244.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to HSH2D on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |