MFAP4 monoclonal antibody (M05), clone 3A5 View larger

MFAP4 monoclonal antibody (M05), clone 3A5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MFAP4 monoclonal antibody (M05), clone 3A5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about MFAP4 monoclonal antibody (M05), clone 3A5

Brand: Abnova
Reference: H00004239-M05
Product name: MFAP4 monoclonal antibody (M05), clone 3A5
Product description: Mouse monoclonal antibody raised against a partial recombinant MFAP4.
Clone: 3A5
Isotype: IgG2a Kappa
Gene id: 4239
Gene name: MFAP4
Gene alias: -
Gene description: microfibrillar-associated protein 4
Genbank accession: NM_002404
Immunogen: MFAP4 (NP_002395, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTL
Protein accession: NP_002395
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004239-M05-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged MFAP4 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy MFAP4 monoclonal antibody (M05), clone 3A5 now

Add to cart