| Brand: | Abnova |
| Reference: | H00079370-M01 |
| Product name: | BCL2L14 monoclonal antibody (M01), clone 1F2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant BCL2L14. |
| Clone: | 1F2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 79370 |
| Gene name: | BCL2L14 |
| Gene alias: | BCLG |
| Gene description: | BCL2-like 14 (apoptosis facilitator) |
| Genbank accession: | BC025778 |
| Immunogen: | BCL2L14 (AAH25778.1, 1 a.a. ~ 327 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD |
| Protein accession: | AAH25778.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (61.71 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | BCL2L14 monoclonal antibody (M01), clone 1F2 Western Blot analysis of BCL2L14 expression in A-549 ( Cat # L025V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |