S100A2 MaxPab mouse polyclonal antibody (B01) View larger

S100A2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of S100A2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about S100A2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00006273-B01
Product name: S100A2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human S100A2 protein.
Gene id: 6273
Gene name: S100A2
Gene alias: CAN19|MGC111539|S100L
Gene description: S100 calcium binding protein A2
Genbank accession: BC002829
Immunogen: S100A2 (AAH02829, 1 a.a. ~ 97 a.a) full-length human protein.
Immunogen sequence/protein sequence: MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Protein accession: AAH02829
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00006273-B01-13-15-1.jpg
Application image note: Western Blot analysis of S100A2 expression in transfected 293T cell line (H00006273-T01) by S100A2 MaxPab polyclonal antibody.

Lane1:S100A2 transfected lysate(10.78 KDa).
Lane 2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy S100A2 MaxPab mouse polyclonal antibody (B01) now

Add to cart