Brand: | Abnova |
Reference: | H00005156-M02 |
Product name: | PDGFRA monoclonal antibody (M02), clone 4H1-1C9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PDGFRA. |
Clone: | 4H1-1C9 |
Isotype: | IgG1 Kappa |
Gene id: | 5156 |
Gene name: | PDGFRA |
Gene alias: | CD140A|MGC74795|PDGFR2|Rhe-PDGFRA |
Gene description: | platelet-derived growth factor receptor, alpha polypeptide |
Genbank accession: | BC015186 |
Immunogen: | PDGFRA (AAH15186, 25 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL |
Protein accession: | AAH15186 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (47.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Proximity Ligation Analysis of protein-protein interactions between CRK and PDGFRA. HeLa cells were stained with anti-CRK rabbit purified polyclonal 1:1200 and anti-PDGFRA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
Applications: | ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |
Publications: | Dicer1 and miR-219 Are Required for Normal Oligodendrocyte Differentiation and Myelination.Dugas JC, Cuellar TL, Scholze A, Ason B, Ibrahim A, Emery B, Zamanian JL, Foo LC, McManus MT, Barres BA. Neuron. 2010 Mar 11;65(5):597-611. |