No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00002909-M01 |
Product name: | GRLF1 monoclonal antibody (M01), clone 4D4-F8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant GRLF1. |
Clone: | 4D4-F8 |
Isotype: | IgG2a kappa |
Gene id: | 2909 |
Gene name: | GRLF1 |
Gene alias: | GRF-1|KIAA1722|MGC10745|P190-A|P190A|p190RhoGAP |
Gene description: | glucocorticoid receptor DNA binding factor 1 |
Genbank accession: | BC003514 |
Immunogen: | GRLF1 (AAH03514, 1 a.a. ~ 36 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR |
Protein accession: | AAH03514 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged GRLF1 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |