No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00002899-M06 |
Product name: | GRIK3 monoclonal antibody (M06), clone 4H1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GRIK3. |
Clone: | 4H1 |
Isotype: | IgG2a Kappa |
Gene id: | 2899 |
Gene name: | GRIK3 |
Gene alias: | EAA5|GLR7|GLUR7|GluR7a |
Gene description: | glutamate receptor, ionotropic, kainate 3 |
Genbank accession: | NM_000831 |
Immunogen: | GRIK3 (NP_000822, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NLYPDYASLSHAILDLVQYLKWRSATVVYDDSTGLIRLQELIMAPSRYNIRLKIRQLPIDSDDSRPLLKEMKRGREFRIIFDCSHTMAAQILKQAMAMGM |
Protein accession: | NP_000822 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |